PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01302.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 300aa    MW: 34592.3 Da    PI: 6.7361
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01302.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.44.6e-56331591129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yLk+kv ++ +++ ++i evd++k+ePw+Lp+k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkat
  Rsa1.0_01302.1_g00005.1  33 LPPGFRFHPTDEELITHYLKPKVFNTFFSA-TAIGEVDLNKIEPWELPRKAKIGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKAT 117
                              79*************************999.88***************99999********************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkdke+++ +++lvg+kktLvfykgrapkg++t+Wvmheyrle
  Rsa1.0_01302.1_g00005.1 118 GKDKEIFK-GKSLVGMKKTLVFYKGRAPKGVRTNWVMHEYRLE 159
                              ********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.05E-6330183IPR003441NAC domain
PROSITE profilePS5100559.90933183IPR003441NAC domain
PfamPF023659.2E-3034158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0010029Biological Processregulation of seed germination
GO:0042542Biological Processresponse to hydrogen peroxide
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048527Biological Processlateral root development
GO:0051091Biological Processpositive regulation of sequence-specific DNA binding transcription factor activity
GO:0090400Biological Processstress-induced premature senescence
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1902074Biological Processresponse to salt
GO:1904250Biological Processpositive regulation of age-related resistance
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MTLIVSQKLY QDKMDYDASR IGEIVQDEEQ IDLPPGFRFH PTDEELITHY LKPKVFNTFF  60
SATAIGEVDL NKIEPWELPR KAKIGEKEWY FFCVRDRKYP TGLRTNRATE AGYWKATGKD  120
KEIFKGKSLV GMKKTLVFYK GRAPKGVRTN WVMHEYRLEG IYSIQHRTQT AKNDWVICRV  180
FHKRADGTKV DKSHLMLLDS HINRIEPIGL PSLMDCSQQD SFPGSSTHVT CFSDQETEDK  240
RLIHHESEDG SGPLFYPDPL FLQDNDSPMK LLLNSHETQF PGTDPSGLAG MGELCCFWNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-573018914171NAC domain-containing protein 19
4dul_A3e-573018914171NAC domain-containing protein 19
1ut7_B3e-573018914171NO APICAL MERISTEM PROTEIN
1ut7_A3e-573018914171NO APICAL MERISTEM PROTEIN
1ut4_B3e-573018914171NO APICAL MERISTEM PROTEIN
1ut4_A3e-573018914171NO APICAL MERISTEM PROTEIN
3swp_D4e-573018917174NAC domain-containing protein 19
3swp_C4e-573018917174NAC domain-containing protein 19
3swp_B4e-573018917174NAC domain-containing protein 19
3swp_A4e-573018917174NAC domain-containing protein 19
3swm_D4e-573018917174NAC domain-containing protein 19
3swm_C4e-573018917174NAC domain-containing protein 19
3swm_B4e-573018917174NAC domain-containing protein 19
3swm_A4e-573018917174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00535DAPTransfer from AT5G39610Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382760.0KF738276.1 Brassica napus NAC transcription factor 92 (NAC92.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013728605.10.0PREDICTED: NAC domain-containing protein 92-like isoform X3
SwissprotQ9FKA01e-171NAC92_ARATH; NAC domain-containing protein 92
TrEMBLM4EA510.0M4EA51_BRARP; Uncharacterized protein
TrEMBLA0A078CC510.0A0A078CC51_BRANA; BnaA04g09470D protein
STRINGBra025658.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39610.11e-173NAC domain containing protein 6